PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0129400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family SRS
Protein Properties Length: 112aa    MW: 12373.7 Da    PI: 5.4636
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0129400.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70267.54.4e-21147109155
           DUF702 109 vsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGleek 155
                      +ss+avf++vrv+s+dd+ +e+aYqt+v+igGh f+GiLydqG+e++
  Lj3g3v0129400.1   1 MSSMAVFSSVRVRSMDDSVNEMAYQTSVNIGGHRFSGILYDQGPEQQ 47 
                      689*****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR016249.5E-17244IPR006511Lateral Root Primordium type 1, C-terminal
PfamPF051425.8E-15245IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MSSMAVFSSV RVRSMDDSVN EMAYQTSVNI GGHRFSGILY DQGPEQQSLN ASPLDQHQNL  60
NLTTIHSHDG ATMAPPSSSA TAAHELFFPQ PRSLASFRVD FETKINFEEK LI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5808231e-163AJ580823.1 Lotus corniculatus var. japonicus ORF1, ORF2, ORF3 and genes for vacuolar proton-ATPase subunit-like protein, papain-like cysteine proteinase-like protein 1 and papain-like cysteine proteinase-like protein 2.
GenBankAP0056661e-163AP005666.1 Lotus japonicus genomic DNA, chromosome 3, clone: LjT09E01, TM0258b.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007131783.11e-29hypothetical protein PHAVU_011G041200g
SwissprotQ9XGX09e-14SHI_ARATH; Protein SHORT INTERNODES
TrEMBLQ70I382e-65Q70I38_LOTJA; CM0216.460.nc protein
STRINGGLYMA12G04310.12e-28(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2269234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.13e-09SHI-related sequence 5